You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576583 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SOX4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SOX4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 47 kDa |
Target | SOX4 |
UniProt ID | Q06945 |
Protein Sequence | Synthetic peptide located within the following region: STASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNA |
NCBI | NP_003098 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CSS10, EVI16 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: SOX4, Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Mouse, Target Name: SOX12, Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: SOX4, Sample Tissue: Human Fetal Stomach, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SOX4, Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.
Host: Rabbit, Target Name: SOX4, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Human Testis
lane 1: Human Testis, primary antibody: SOX4 antibody - N-terminal region (orb576583), primary antibody dilution: 1:1000, secondary antibody: goat anti-rabbit-HRP, secondary antibody dilution: 1:10000, blocking buffer: 3% milk in TBST, Actual Primary Conc (mg/mL): 0.9, Expected Primary Conc (mg/mL): 0.5.
lane 1: Human Testis, primary antibody:SOX4 antibody - N-terminal region (orb576583), primary antibody dilution: 1:1000, secondary antibody: goat anti-rabbit-HRP, secondary antibody dilution: 1:10000, blocking buffer: 3% milk in TBST, Actual Primary Conc (mg/mL): 1.9, Expected Primary Conc (mg/mL): 0.5.
WB Suggested Anti-SOX4 Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.
WB Suggested Anti-SOX4 Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate.
FC, IHC-P, WB | |
Gallus | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating