SOX4 antibody

• Catalog Number: orb576583
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SOX4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SOX4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47 kDa
• Target: SOX4
• UniProt ID: Q06945
• Protein Sequence: Synthetic peptide located within the following region: STASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNA
• NCBI: NP_003098
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CSS10, EVI16
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: SOX4, Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Mouse, Target Name: SOX12, Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: SOX4, Sample Tissue: Human Fetal Stomach, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: SOX4, Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Host: Rabbit, Target Name: SOX4, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Human Testis

lane 1: Human Testis, primary antibody: SOX4 antibody - N-terminal region (orb576583), primary antibody dilution: 1:1000, secondary antibody: goat anti-rabbit-HRP, secondary antibody dilution: 1:10000, blocking buffer: 3% milk in TBST, Actual Primary Conc (mg/mL): 0.9, Expected Primary Conc (mg/mL): 0.5.

lane 1: Human Testis, primary antibody:SOX4 antibody - N-terminal region (orb576583), primary antibody dilution: 1:1000, secondary antibody: goat anti-rabbit-HRP, secondary antibody dilution: 1:10000, blocking buffer: 3% milk in TBST, Actual Primary Conc (mg/mL): 1.9, Expected Primary Conc (mg/mL): 0.5.

WB Suggested Anti-SOX4 Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.

WB Suggested Anti-SOX4 Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate.