SOX2 Rabbit Polyclonal Antibody

• Catalog Number: orb576582
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SOX2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SOX2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 34kDa
• Target: SOX2
• UniProt ID: P48431
• Protein Sequence: Synthetic peptide located within the following region: AGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSH
• NCBI: NP_003097
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ANOP3, MCOPS3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 2. mouse brain extracts (80 ug), 3. rat brain extract (80 ug), Primary Antibody Dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000.

Sample Type: Human brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: SOX2: Red DAPI:Blue, Gene Name: SOX2.

WB Suggested Anti-SOX2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate.

WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human Hela.

WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human Hela.

WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human OVCAR-3.

WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human OVCAR-3.