You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576582 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SOX2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SOX2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 34kDa |
Target | SOX2 |
UniProt ID | P48431 |
Protein Sequence | Synthetic peptide located within the following region: AGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSH |
NCBI | NP_003097 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ANOP3, MCOPS3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 2. mouse brain extracts (80 ug), 3. rat brain extract (80 ug), Primary Antibody Dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody Dilution: 1:20000.
Sample Type: Human brain stem cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary Antibody Dilution: 1:1000, Color/Signal Descriptions: SOX2: Red DAPI:Blue, Gene Name: SOX2.
WB Suggested Anti-SOX2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate.
WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human Hela.
WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human Hela.
WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human OVCAR-3.
WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human OVCAR-3.
IHC, WB | |
Bovine, Canine, Equine, Goat, Porcine, Rabbit, Rat, Sheep, Zebrafish | |
Frog, Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating