SOX2 Rabbit Polyclonal Antibody

• Catalog Number: orb576581
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SOX2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Goat, Mouse, Porcine, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SOX2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 34kDa
• Target: SOX2
• UniProt ID: P48431
• Protein Sequence: Synthetic peptide located within the following region: AAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAE
• NCBI: NP_003097
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ANOP3, MCOPS3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Hela, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human Hela.

WB Suggested Anti-SOX2 antibody Titration: 1 ug/ml, Sample Type: Human OVCAR-3.

WB Suggested Anti-SOX2 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate.