You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573909 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SOX2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Animal, Bovine, Canine, Goat, Human, Mouse, Porcine, Rat, Sheep, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SOX2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 34kDa |
Target | SOX2 |
UniProt ID | P48431 |
Protein Sequence | Synthetic peptide located within the following region: MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMV |
NCBI | NP_003097 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ANOP3, MCOPS3 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: SOX2, Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.
Host: Mouse, Target Name: SOX2, Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml.
Host: Rabbit, Target Name: SOX2, Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SOX2, Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.
Human kidney
Human Spleen
Application:IHC Species+tissue/cell type: Xenopus laevis cornea epithellium Primary antibody dilution: 1:300 Secondary antibody:Goat anti-rabbit -rhodamine Secondary antibody dilution: 1:300.
Sample Type: Lane 1: 20 ug U87 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:2000.
WB Suggested Anti-SOX2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:500, Positive Control: OVCAR-3 cell lysate, There is BioGPS gene expression data showing that SOX2 is expressed in OVCAR3.
Filter by Rating