SOX10 antibody

• Catalog Number: orb574604
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SOX10
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SOX10
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50 kDa
• Target: SOX10
• UniProt ID: P56693
• Protein Sequence: Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT
• NCBI: NP_008872
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: DOM, WS4, PCWH, WS2E, WS4C
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

A/ [IHC-PZ] (optimal processing) human optic nerve (short post mortem interval) fixed by immersion in zinc-based fixative (BD Pharmingen 552658), processed to minimize antigen loss (shortened protocol, reduced exposure to high temperature); embedded in paraffin wax; sectioned at 3 microns A2/ [IHC-PZ + FF] As above for initial fixation then post-fixed in 10% buffered formalin for 5 days B/ [IHC-P] human optic nerve and spinal cord fixed in 10% buffered formalin (relatively short post mortem interval and fixation duration); standard processing; embedded in paraffin wax; sectioned at 3 microns Controls Negative: omission of primary. Positive: Olig2 reactivity was in comparison with antibody used at 1:10000 (IHC-PZ); 1:4000 (IHC-P).

Host: Rabbit, Target Name: SOX10, Sample Tissue: Human 293T Whole Cell, Antibody dilution: 3 ug/ml.

Host: Rabbit, Target Name: SOX10, Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

Host: Rabbit, Target Name: SOX10, Sample Type: HepG2 Whole Cell lysates, Antibody dilution: 0.5 ug/ml.

Host: Rabbit, Target Name: SOX10, Sample Type: Jurkat cell lysates, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 4.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Host: Rabbit, Target: SOX10, Positive control (+): Rat brain (R-BR), Negative control (-): Mouse intestine (M-IN), Antibody concentration: 1 ug/ml.

SOX10 antibody - middle region (orb574604) validated by WB using Hek 293 Whole Cell Lysate at 1:4, 000.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-SOX10 Antibody Titration: 25 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.