You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584029 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SOD2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish |
Reactivity | Human, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SOD2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 25 kDa |
Target | SOD2 |
UniProt ID | P04179 |
Protein Sequence | Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH |
NCBI | NP_000627 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | IPOB, IPO-B, MNSOD, MVCD6, GClnc1, Mn-SOD Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: NOP56, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: NOP56, Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SOD2, Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.
Lanes: 1. 40 ug HK2 cell (kidney proximal tubular cell line) 2. 40 ug H2O2 treated human HK2 Cell lysate, 3. 40 ug H2O2 treated human HK2 Cell lysate, 4. 40 ug H2O2 treated human HK2 Cell lysate, 5. 40 ug H2O2 treated human HK2 Cell lysate, 6. 40 ug H2O2 treated human HK2 Cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Goat anti-Rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: SOD2.
Lanes: 1. 40 ug rat dorsal medulla brain extract 2. 20 ug rat cortax + hypothalamus mitochondria extract, Primary Antibody dilution: 1:2500, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: SOD2.
WB Suggested Anti-SOD2 antibody, Titration: 0.4 ug/ml, Positive Control: Rat dorsal medulla brain & cortax + hypothalamus extract.
WB Suggested Anti-SOD2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Placenta.
ELISA, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Bovine, Canine, Human, Mouse, Porcine, Rat, Zebrafish | |
Goat | |
Polyclonal | |
Unconjugated |
Filter by Rating