SNX4 monoclonal antibody (M01), clone 4H8

• Catalog Number: orb2291844
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SNX4.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4H8
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: SNX4 (AAH18762, 341 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: QCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKEALISYAVMQISMCKKGIQVWTNAKECFSKM
• NCBI: AAH18762
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

SNX4 monoclonal antibody (M01), clone 4H8 Western Blot analysis of SNX4 expression in A-431.

Western Blot detection against Immunogen (37.73 KDa).