You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578909 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SNTB1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Equine, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SNTB1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58 kDa |
Target | SNTB1 |
UniProt ID | Q13884 |
Protein Sequence | Synthetic peptide located within the following region: GAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQEL |
NCBI | NP_066301 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | A1B, SNT2, BSYN2, 59-DAP, DAPA1B, SNT2B1, TIP-43 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing a peptide sequence is present at 41 kDa.
Host: Rabbit, Target Name: SNTB1, Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SNTB1, Sample Type: Human HepG2, Antibody Dilution: 1.0 ug/ml. SNTB1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
WB Suggested Anti-SNTB1 Antibody Titration: 0.2-1 ug/ml, Positive Control: ACHN cell lysate.
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Canine, Equine, Human, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating