SNTB1 antibody

• Catalog Number: orb578909
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SNTB1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNTB1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58 kDa
• Target: SNTB1
• UniProt ID: Q13884
• Protein Sequence: Synthetic peptide located within the following region: GAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQEL
• NCBI: NP_066301
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: A1B, SNT2, BSYN2, 59-DAP, DAPA1B, SNT2B1, TIP-43
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing a peptide sequence is present at 41 kDa.

Host: Rabbit, Target Name: SNTB1, Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: SNTB1, Sample Type: Human HepG2, Antibody Dilution: 1.0 ug/ml. SNTB1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

WB Suggested Anti-SNTB1 Antibody Titration: 0.2-1 ug/ml, Positive Control: ACHN cell lysate.