You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324891 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SNRNP35 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human U1SNRNPBP |
Concentration | 1.0 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 28kDa |
Target | SNRNP35 |
UniProt ID | Q5XKN9 |
Protein Sequence | Synthetic peptide located within the following region: RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR |
NCBI | NP_851034 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HM-1 antibody, anti U1SNRNPBP antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of Jurkat cell lysate tissue using SNRNP35 antibody
Immunohistochemical staining of human Kidney tissue using SNRNP35 antibody
Rabbit Anti-U1SNRNPBP Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
WB Suggested Anti-U1SNRNPBP Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate.
Filter by Rating