SNAI2 antibody

• Catalog Number: orb574596
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SNAI2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast
• Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Sheep, Yeast
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SNAI2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 30kDa
• Target: SNAI2
• UniProt ID: O43623
• Protein Sequence: Synthetic peptide located within the following region: SDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFS
• NCBI: NP_003059
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SLUG, WS2D, SLUGH, SLUGH1, SNAIL2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: SNAI2, Sample Tissue: Human Jurkat, Antibody dilution: 1.0 ug/ml.

Human kidney

Testis

WB Suggested Anti-SNAI2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Transfected 293T.