You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574602 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SNAI1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Guinea pig, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SNAI1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 29kDa |
Target | SNAI1 |
UniProt ID | O95863 |
Protein Sequence | Synthetic peptide located within the following region: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL |
NCBI | NP_005976 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SNA, SNAH, SNAIL, SLUGH2, SNAIL1, dJ710H13.1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Mouse, Target Name: SNAI1, Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.
Human kidney
Rabbit Anti-SNAI1 Antibody, Catalog Number: orb574602, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SNAI1 Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate, SNAI1 is supported by BioGPS gene expression data to be expressed in 721_B.
WB Suggested Anti-SNAI1 antibody Titration: 1 ug/ml, Sample Type: Human 721_B.
WB Suggested Anti-SNAI1 antibody Titration: 1 ug/ml, Sample Type: Human A549.
ELISA, IHC-P, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC-P, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating