Cart summary

You have no items in your shopping cart.

    SMN1/2 Antibody

    Catalog Number: orb251581

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb251581
    CategoryAntibodies
    DescriptionSMN1/2 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC, WB
    Predicted ReactivityHamster
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2 (22-52aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH), identical to the related mouse and rat sequences.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW31849 MW
    UniProt IDQ16637
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesSurvival motor neuron protein;Component of gems 1;
    Read more...
    NoteFor research use only
    Application notesWB: The detection limit for SMN1/2 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    SMN1/2 Antibody

    IHC(P) analysis of Mouse Brain Tissue using Anti-SMN1/2 Picoband antibody.

    SMN1/2 Antibody

    IHC(P) analysis of Rat Brain Tissue using Anti-SMN1/2 Picoband antibody.

    SMN1/2 Antibody

    IHC(P) analysis of Human Mammary Cancer Tissue using Anti-SMN1/2 Picoband antibody.

    SMN1/2 Antibody

    Flow Cytometry analysis of A431 cells using anti-SMN1/2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    SMN1/2 Antibody

    Western blot analysis using Anti-SMN1/2 Picoband antibody.Lane 1:Rat Brain Tissue;2:Mouse Brain Tissue;3:Rat Liver Tissue;4:Mouse Liver Tissue;5:293T Cell;6:SMMC Cell;7:HEPG2 Cell;8:HELA Cell.

    SMN1/2 Antibody

    IF analysis of SMN1/2 using anti-SMN1/2 antibody. SMN1/2 was detected in immunocytochemical section of U20S cells.

    • SMN1/2 Antibody (monoclonal, 2B10) [orb421125]

      ICC,  IHC,  WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      10 μg, 100 μg
    • SMN1/2 antibody [orb1177299]

      IHC-P,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars