You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb251581 |
---|---|
Category | Antibodies |
Description | SMN1/2 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Predicted Reactivity | Hamster |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2 (22-52aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 31849 MW |
UniProt ID | Q16637 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Survival motor neuron protein;Component of gems 1; Read more... |
Note | For research use only |
Application notes | WB: The detection limit for SMN1/2 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
IHC(P) analysis of Mouse Brain Tissue using Anti-SMN1/2 Picoband antibody.
IHC(P) analysis of Rat Brain Tissue using Anti-SMN1/2 Picoband antibody.
IHC(P) analysis of Human Mammary Cancer Tissue using Anti-SMN1/2 Picoband antibody.
Flow Cytometry analysis of A431 cells using anti-SMN1/2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
Western blot analysis using Anti-SMN1/2 Picoband antibody.Lane 1:Rat Brain Tissue;2:Mouse Brain Tissue;3:Rat Liver Tissue;4:Mouse Liver Tissue;5:293T Cell;6:SMMC Cell;7:HEPG2 Cell;8:HELA Cell.
IF analysis of SMN1/2 using anti-SMN1/2 antibody. SMN1/2 was detected in immunocytochemical section of U20S cells.
ICC, IHC, WB | |
Human, Mouse, Rat | |
Mouse | |
Monoclonal | |
Unconjugated |
Filter by Rating