You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb421125 |
---|---|
Category | Antibodies |
Description | SMN1/2 Antibody (monoclonal, 2B10) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2B10 |
Tested applications | ICC, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Mouse IgG1 |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2 (22-52aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 39 kDa |
UniProt ID | Q16637 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Survival motor neuron protein; Component of gems 1 Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of SMN1/2 using anti-SMN1/2 antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human SW620 cell;4:human PANC-1 cell;5:human HepG2 cell;6:human A549 cell;7:rat RH35 cell;8:mouse HEPA1-6 cell.
IHC analysis of SMN1/2 using anti-SMN1/2 antibody.SMN1/2 was detected in paraffin-embedded section of human mammary cancer tissue.
IHC analysis of SMN1/2 using anti-SMN1/2 antibody.SMN1/2 was detected in paraffin-embedded section of human mammary cancer tissue.
IHC analysis of SMN1/2 using anti-SMN1/2 antibody.SMN1/2 was detected in immunocytochemical section of A431 cell.
Filter by Rating