You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326150 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SMG8 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C17orf71 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 110kDa |
Target | SMG8 |
UniProt ID | Q8ND04 |
Protein Sequence | Synthetic peptide located within the following region: HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF |
NCBI | NP_060619 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ10587 antibody, anti C17orf71 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Fetal Liver tissue using SMG8 antibody
Western blot analysis of human Fetal Heart tissue using SMG8 antibody
Western blot analysis of human Fetal Brain tissue using SMG8 antibody
Western blot analysis of 721_B cell lysate tissue using SMG8 antibody
Western blot analysis of human Placenta tissue using SMG8 antibody
Western blot analysis of human Fetal Lung tissue using SMG8 antibody
Host: Rabbit, Target Name: SMG8, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: SMG8, Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: SMG8, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: SMG8, Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: SMG8, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
WB Suggested Anti-C17orf71 Antibody Titration: 0.2-1 ug/mL, Positive Control: 721_B cell lysate, SMG8 is supported by BioGPS gene expression data to be expressed in 721_B.
Filter by Rating