SMC1A Rabbit Polyclonal Antibody

• Catalog Number: orb576827
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SMC1A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SMC1A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 143kDa
• Target: SMC1A
• UniProt ID: Q14683
• Protein Sequence: Synthetic peptide located within the following region: VISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ
• NCBI: NP_006297
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SMC1, SMCB, CDLS2, DEE85, SB1.8, EIEE85, SMC1L1, D
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human HepG2, Antibody Dilution: 1.0 ug/ml. SMC1A is supported by BioGPS gene expression data to be expressed in HepG2.

Sample Type: Human Jurkat, Antibody Dilution: 1.0 ug/ml. SMC1A is supported by BioGPS gene expression data to be expressed in Jurkat.

Rabbit Anti-SMC1A Antibody, Catalog Number: orb576827, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SMC1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate. SMC1A is supported by BioGPS gene expression data to be expressed in HEK293T.