You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576827 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SMC1A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SMC1A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 143kDa |
Target | SMC1A |
UniProt ID | Q14683 |
Protein Sequence | Synthetic peptide located within the following region: VISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ |
NCBI | NP_006297 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SMC1, SMCB, CDLS2, DEE85, SB1.8, EIEE85, SMC1L1, D Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: SMC1A, Sample Type: Human HepG2, Antibody Dilution: 1.0 ug/ml. SMC1A is supported by BioGPS gene expression data to be expressed in HepG2.
Host: Rabbit, Target Name: SMC1A, Sample Type: Human Jurkat, Antibody Dilution: 1.0 ug/ml. SMC1A is supported by BioGPS gene expression data to be expressed in Jurkat.
Rabbit Anti-SMC1A Antibody, Catalog Number: orb576827, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SMC1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate. SMC1A is supported by BioGPS gene expression data to be expressed in HEK293T.
IHC, IP, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating