SMARCD1 antibody

• Catalog Number: orb583959
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SMARCD1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SMARCD1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 58kDa
• Target: SMARCD1
• UniProt ID: Q96GM5
• Protein Sequence: Synthetic peptide located within the following region: RKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQ
• NCBI: NP_003067
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CSS11, Rsc6p, BAF60A, CRACD1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: SMARCD1, Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.

Host: Rabbit, Target Name: SMARCD1, Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

WB Suggested Anti-SMARCD1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Liver.