You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584258 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLPI |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLPI |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 12kDa |
Target | SLPI |
UniProt ID | P03973 |
Protein Sequence | Synthetic peptide located within the following region: VLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGK |
NCBI | NP_003055 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ALP, MPI, ALK1, BLPI, HUSI, WAP4, WFDC4, HUSI-I Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: SLPI, Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-SLPI Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human heart.
Bovine, Equine, Gallus, Goat, Human, Porcine |
Filter by Rating