You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578985 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLCO2B1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLCO2B1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 77kDa |
Target | SLCO2B1 |
UniProt ID | O94956 |
Protein Sequence | Synthetic peptide located within the following region: DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ |
NCBI | NP_009187 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | OATPB, OATP-B, OATP2B1, SLC21A9 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: SLCO2B1, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SLCO2B1, Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: SLCO2B1, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target: SLCO2B1, Positive control (+): HepG2 (HG), Negative control (-): 293T (2T), Antibody concentration: 3 ug/ml.
Rabbit Anti-SLCO2B1 Antibody, Catalog Number: orb578985, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Membrane in alveolar type I cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SLCO2B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. SLCO2B1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
IHC-P, WB | |
Bovine, Canine, Equine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating