SLC7A7 antibody

• Catalog Number: orb588361
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC7A7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SLC7A7
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 56 kDa
• Target: SLC7A7
• UniProt ID: Q9UM01
• Protein Sequence: Synthetic peptide located within the following region: RVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
• NCBI: NP_001119577.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LPI, LAT3, MOP-2, Y+LAT1, y+LAT-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: SLC7A7, Sample Tissue: Human 721_B lymphoblast Whole Cell lysates, Antibody Dilution: 1 ug/ml.