You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325097 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC7A7 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC7A7 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | SLC7A7 |
UniProt ID | Q9UM01 |
Protein Sequence | Synthetic peptide located within the following region: WGTLVQDIFTYAKVLALIGIVRLGQGASTHFENSFEGSSFAVGDI |
NCBI | NP_003973 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti LAT3 antibody, anti LPI antibody, anti Y+LAT1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: SLC7A7, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Host: Rabbit, Target Name: SLC7A7, Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
Rabbit Anti-SLC7A7 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SLC7A7 Antibody Titration: 0.2-1 ug/mL, Positive Control: PANC1 cell lysate.
Filter by Rating