You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585727 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC7A5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | SLC7A5 |
UniProt ID | Q01650 |
Protein Sequence | Synthetic peptide located within the following region: MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
NCBI | NP_003477 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | E16, CD98, LAT1, 4F2LC, MPE16, D16S469E Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: SLC7A5, Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. SLC7A5 is supported by BioGPS gene expression data to be expressed in 721_B.
Host: Rabbit, Target Name: SLC7A5, Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. SLC7A5 is supported by BioGPS gene expression data to be expressed in HeLa.
Host: Rabbit, Target Name: SLC7A5, Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. SLC7A5 is supported by BioGPS gene expression data to be expressed in HepG2.
WB Suggested Anti-SLC7A5 Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.
Filter by Rating