You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb402586 |
---|---|
Category | Antibodies |
Description | SLC7A3 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human SLC7A3 (1-30aa MPWQAFRRFGQKLVRRRTLESGMAETRLAR), different from the related mouse and rat sequences by four amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 67169 MW |
UniProt ID | Q8WY07 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Cationic amino acid transporter 3;CAT-3;CAT3;Catio Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of SLC7A3 using anti-SLC7A3 antibody.Lane 1:human A431 Cell.
Filter by Rating