SLC7A2 antibody

• Catalog Number: orb578925
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC7A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC7A2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 72kDa
• Target: SLC7A2
• UniProt ID: P52569
• Protein Sequence: Synthetic peptide located within the following region: VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC
• NCBI: NP_001008539
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CAT2, ATRC2, HCAT2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target: SLC7A2, Positive control (+): MCF7 (N10), Negative control (-): Human brain (BR), Antibody concentration: 1 ug/ml.

WB Suggested Anti-SLC7A2 Antibody Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.