SLC7A11 antibody

• Catalog Number: orb325112
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC7A11
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC7A11
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: SLC7A11
• UniProt ID: Q9UPY5
• Protein Sequence: Synthetic peptide located within the following region: KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK
• NCBI: NP_055146
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CCBR1 antibody, anti xCT antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

References

Liu, Dishiwen et al. Cardiac Fibroblasts Promote Ferroptosis in Atrial Fibrillation by Secreting Exo-miR-23a-3p Targeting SLC7A11 Oxid Med Cell Longev, 2022, 3961495 (2022)

PubMed: 35677105

Host: Rabbit, Target: SLC7A11, Positive control (+): HeLa Cell Lysate (HL), Negative control (-): MCF7 Cell Lysate (N10), Antibody concentration: 3 ug/mL.

WB Suggested Anti-SLC7A11 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: THP-1 cell lysate.