SLC6A2 antibody

• Catalog Number: orb324970
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC6A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC6A2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 69kDa
• Target: SLC6A2
• UniProt ID: P23975
• Protein Sequence: Synthetic peptide located within the following region: STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF
• NCBI: NP_001034
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti NAT1 antibody, anti NET antibody, anti NET1 a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Placenta tissue using SLC6A2 antibody

Western blot analysis of human Fetal Lung tissue using SLC6A2 antibody

Western blot analysis of human heart tissue using SLC6A2 antibody

Western blot analysis of human Fetal Heart tissue using SLC6A2 antibody

Western blot analysis of human Fetal Heart tissue using SLC6A2 antibody

Host: Mouse, Target Name: SLC6A2, Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: SLC6A2, Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: SLC6A2, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: SLC6A2, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: SLC6A2, Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: SLC6A2, Sample Type: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Host: Rabbit, Target: SLC6A2, Positive control (+): Human Placenta (PL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.

WB Suggested Anti-SLC6A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human heart.