SLC6A2 antibody

• Catalog Number: orb324969
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC6A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC6A2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 69 kDa
• Target: SLC6A2
• UniProt ID: O55192
• Protein Sequence: Synthetic peptide located within the following region: FTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGV
• NCBI: NP_001034
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti NAT1 antibody, anti NET antibody, anti NET1 a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of HepG2 cell lysate tissue using SLC6A2 antibody

25 ug of the indicated Mouse whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Multiple isoforms can be identified with this antibody from 57-69 kDa in human and mouse tissues.

Host: Rabbit, Target Name: SLC6A2, Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

Application: Western blotting, Species + Tissue/Cell type: 1: 50 ug human placenta lysate, 2: 50 ug human placenta lysate, 3: 50 ug sheep placenta lysate, 4: 50 ug sheep placenta lysate, Primary antibody Dilution: 1:1000, Secondary antibody: Anti-rabbit HRP, Secondary antibody Dilution: 1:20000.

WB Suggested Anti-SLC6A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.