You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326450 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC50A1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 24kDa |
Target | SLC50A1 |
UniProt ID | Q9BRV3 |
Protein Sequence | Synthetic peptide located within the following region: SMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIM |
NCBI | NP_061333 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti SCP antibody, anti slv antibody, anti SWEET1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of MCF7 Whole Cell tissue using SLC50A1 antibody
WB Suggested Anti-SLC50A1 Antibody, Titration: 1.0 ug/mL, Positive Control: MCF7 Whole Cell, SLC50A1 is supported by BioGPS gene expression data to be expressed in MCF7.
Filter by Rating