You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325125 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC46A1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC46A1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 50 kDa |
Target | SLC46A1 |
UniProt ID | Q96NT5 |
Protein Sequence | Synthetic peptide located within the following region: MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR |
NCBI | NP_542400 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti HCP1 antibody, anti MGC9564 antibody, anti PC Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 2 ug/mL.
WB Suggested Anti-SLC46A1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:2500, Positive Control: OVCAR-3 cell lysate.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Gallus, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
FC, ICC, IF | |
Bovine, Gallus, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
PE/Cy5 |