SLC39A8 antibody

• Catalog Number: orb325120
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC39A8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Porcine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A8
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50kDa
• Target: SLC39A8
• UniProt ID: Q9C0K1
• Protein Sequence: Synthetic peptide located within the following region: QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS
• NCBI: NP_071437
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti BIGM103 antibody, anti LZT-Hs6 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Pancreas (Cancer) & rat pancreas, Primary Antibody Dilution: 1:150, Secondary Antibody: Goat anti-Rabbit, Secondary Antibody Dilution: 1:300, Gene Name: SLC39A8.

WB Suggested Anti-SLC39A8 Antibody Titration: 0.2-1 ug/mL, Positive Control: NCI-H226 cell lysate, There is BioGPS gene expression data showing that SLC39A8 is expressed in NCIH226.