SLC39A6 antibody

• Catalog Number: orb578987
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC39A6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC39A6
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 85 kDa
• Target: SLC39A6
• UniProt ID: Q13433
• Protein Sequence: Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN
• NCBI: NP_001092876
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ZIP6, LIV-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 85 kDa and 49 kDa and the protein may be modified by phosphorylation and/or glycosylation. The canonical 85 kDa isoform was undetectable in these samples.

Host: Rabbit, Target Name: HIRIP3, Sample Type: 293T, Antibody Dilution: 1.0 ug/ml. SLC39A6 is strongly supported by BioGPS gene expression data to be expressed in HEK293T.

Host: Rabbit, Target Name: NOP56, Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: NOP56, Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. SLC39A6 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

Host: Rabbit, Target Name: WT1, Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. SLC39A6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Human kidney

WB Suggested Anti-SLC39A6 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.