You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330368 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC39A5 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A5 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | SLC39A5 |
UniProt ID | Q6ZMH5 |
Protein Sequence | Synthetic peptide located within the following region: MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG |
NCBI | NP_775867 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti LZT-Hs7 antibody, anti MGC34778 antibody, ant Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: SLC39A5, Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.
Human Liver
Rabbit Anti-SLC39A5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-SLC39A5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Prostate, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-SLC39A5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Uterus, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SLC39A5 Antibody Titration: 0.5 ug/mL, Positive Control: HepG2 cell lysate.
ELISA, IF, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating