SLC29A2 antibody

• Catalog Number: orb578943
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC29A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC29A2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50kDa
• Target: SLC29A2
• UniProt ID: Q14542
• Protein Sequence: Synthetic peptide located within the following region: ARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL
• NCBI: NP_001523
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ENT2, DER12, HNP36
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

WB Suggested Antibody Titration: 2.5 ug/ml, Positive Control: HepG2.