You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578965 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC27A2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLC27A2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 70 kDa |
Target | SLC27A2 |
UniProt ID | O14975 |
Protein Sequence | Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW |
NCBI | NP_003636 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | VLCS, FATP2, VLACS, ACSVL1, FACVL1, hFACVL1, HsT17 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 70 kDa isoform is identified, and a second isoform of 65 kDa is also present in some samples.
Host: Rabbit, Target Name: SLC27A2, Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%. SLC27A2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
Host: Rabbit, Target: SLC27A2, Positive control (+): Hela (HL), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml.
Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE).
Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE).
WB Suggested Anti-SLC27A2 Antibody Titration: 1 ug/ml, Positive Control: Hela cell lysate.
WB Suggested Anti-SLC27A2 Antibody Titration: 1 ug/ml, Positive Control: Jurkat lysate.
WB Suggested Anti-SLC27A2 antibody Titration: 1 ug/ml, Sample Type: Human MCF7.
WB Suggested Anti-SLC27A2 antibody Titration: 1 ug/ml, Sample Type: Human PANC1.
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating