SLC26A8 antibody

• Catalog Number: orb330364
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC26A8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SLC26A8
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61kDa
• Target: SLC26A8
• UniProt ID: Q5JVR5
• Protein Sequence: Synthetic peptide located within the following region: EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV
• NCBI: CAI40882
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti RP11-482O9.1 antibody, anti FLJ32714 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Brain

WB Suggested Anti-SLC26A8 Antibody Titration: 5.0 ug/mL, Positive Control: Jurkat cell lysate.