You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578191 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC26A4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC26A4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 86 kDa |
Target | SLC26A4 |
UniProt ID | O43511 |
Protein Sequence | Synthetic peptide located within the following region: ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL |
NCBI | NP_000432 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | EVA, PDS, DFNB4, TDH2B Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The canonical isoform of 86 kDa is present as well as a second isoform around 39 kDa.
Host: Rabbit, Target Name: SLC26A4, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: SLC26A4, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.
Host: Rabbit, Target Name: SLC26A4, Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.
Host: Rabbit, Target Name: SLC26A4, Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 3 ug/ml.
Host: Rabbit, Target Name: SLC26A4, Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/ml.
Immunohistochemistry with Placenta tissue at an antibody concentration of 5 ug/ml using anti-SLC26A4 antibody (orb578191).
WB Suggested Anti-SLC26A4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: COLO205 cell lysate.
Filter by Rating