SLC25A4 antibody

• Catalog Number: orb578940
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC25A4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33 kDa
• Target: SLC25A4
• UniProt ID: Q05962
• Protein Sequence: Synthetic peptide located within the following region: LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT
• NCBI: NP_001142
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: T1, ANT, AAC1, ANT1, PEO2, PEO3, ANT 1, PEOA2, MTD
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. A smaller isoform may also be identified with this antibody at 22 kDa.

Host: Rabbit, Target Name: SLC25A4, Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: SLC25A4, Sample Tissue: Human DLD1 Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: SLC25A4, Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: SLC25A4, Sample Tissue: Human RPMI-8226, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: SLC25A4, Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target: SLC25A4, Positive control (+): MCF7 (N10), Negative control (-): A549 (N03), Antibody concentration: 1 ug/ml.

Host: Rat, Target Name: SLC25A4, Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Rabbit Anti-SLC25A4 Antibody, Catalog Number: orb578940, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SLC25A4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: RPMI 8226 cell lysate. SLC25A4 is supported by BioGPS gene expression data to be expressed in RPMI 8226.