You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330351 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC20A1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Human, Porcine, Rabbit, Rat |
Reactivity | Canine, Equine, Human, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SLC20A1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 74 kDa |
Target | SLC20A1 |
UniProt ID | Q8WUM9 |
Protein Sequence | Synthetic peptide located within the following region: LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL |
NCBI | NP_005406 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti DKFZp686J2397 antibody, anti FLJ41426 antibod Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of MCF7 cell lysate tissue using SLC20A1 antibody
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
WB Suggested Anti-SLC20A1 Antibody Titration: 0.2-1 ug/mL, Positive Control: MCF7 cell lysate.
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating