SLC20A1 antibody

• Catalog Number: orb330351
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC20A1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Human, Porcine, Rabbit, Rat
• Reactivity: Canine, Equine, Human, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SLC20A1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 74 kDa
• Target: SLC20A1
• UniProt ID: Q8WUM9
• Protein Sequence: Synthetic peptide located within the following region: LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL
• NCBI: NP_005406
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZp686J2397 antibody, anti FLJ41426 antibod
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of MCF7 cell lysate tissue using SLC20A1 antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

WB Suggested Anti-SLC20A1 Antibody Titration: 0.2-1 ug/mL, Positive Control: MCF7 cell lysate.