You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329750 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC1A2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC1A2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 62kDa |
Target | SLC1A2 |
UniProt ID | P43004 |
Protein Sequence | Synthetic peptide located within the following region: LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEM |
NCBI | NP_004162 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti EAAT2 antibody, anti GLT-1 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of HT1080 cell lysate tissue using SLC1A2 antibody
Immunohistochemical staining of human brain tissue using SLC1A2 antibody
Anti-SLC1A2 / EAAT2 antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. SLC1A2 Antibody orb329750 concentration 5 ug/mL.
WB Suggested Anti-SLC1A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: HT1080 cell lysate.
IHC, WB | |
Bovine, Canine, Equine | |
Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC, WB | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Mouse, Rabbit | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating