SLC1A2 antibody

• Catalog Number: orb329749
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC1A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine
• Reactivity: Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC1A2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 62kDa
• Target: SLC1A2
• UniProt ID: P43004
• Protein Sequence: Synthetic peptide located within the following region: PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK
• NCBI: NP_004162
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti EAAT2 antibody, anti GLT-1 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human brain tissue using SLC1A2 antibody

Immunohistochemical staining of human brain tissue using SLC1A2 antibody

Immunohistochemical staining of human Lung tissue using SLC1A2 antibody

Western blot analysis of Fetal Brain tissue using SLC1A2 antibody

Western blot analysis of human Fetal Brain tissue using SLC1A2 antibody

Anti-SLC1A2 / EAAT2 antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. SLC1A2 Antibody orb329749 concentration 5 ug/mL.

Host: Rabbit, Target Name: SLC1A2, Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL.

Host: Rabbit, Target Name: SLC1A2, Sample Type: Fetal Brain lysates, Antibody Dilution: 1.0 ug/mL.

Host: Rabbit, Target Name: SLC1A2, Sample Type: Fetal Brain, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/Lane, Gel Concentration: 0.12.

Host: Rat, Target Name: SLC1A2, Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

Host: Rat, Target Name: SLC1A2, Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

Rabbit Anti-SLC1A2 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-SLC1A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human brain.