SLC14A1 antibody

• Catalog Number: orb580282
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC14A1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Mouse, Porcine, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SLC14A1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42kDa
• Target: SLC14A1
• UniProt ID: Q13336
• Protein Sequence: Synthetic peptide located within the following region: LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM
• NCBI: NP_056949
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: JK, UT1, UTE, HUT11, Jk(b), RACH1, RACH2, UT-B1, H
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target Name: SLC14A1, Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

Human kidney

WB Suggested Anti-SLC14A1 Antibody Titration: 0.25 ug/ml, Positive Control: Jurkat cell lysate.