SLC12A1 antibody

• Catalog Number: orb578031
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC12A1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC12A1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: SLC12A1
• UniProt ID: Q8IUN5
• Protein Sequence: Synthetic peptide located within the following region: NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANI
• NCBI: AAH40138
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BSC1, NKCC2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is present in multiple isoforms including 46 kDa.

Host: Rabbit, Target Name: SLC12A1, Sample Tissue: Human A549, Antibody Dilution: 1.0 ug/ml.

Host: Rabbit, Target Name: SLC12A1, Sample Tissue: Human PC-3 Whole Cell, Antibody Dilution: 5 ug/ml.

Host: Rabbit, Target Name: SLC12A1, Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/ml.

Host: Rabbit, Target Name: SLC12A1, Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Host: Rabbit, Target: SLC12A1, Positive control (+): Mouse kidney (M-KI), Negative control (-): Mouse intestine (M-IN), Antibody concentration: 1 ug/ml.

Rabbit Anti-SLC12A1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SLC12A1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.