You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb316608 |
---|---|
Category | Antibodies |
Description | SLC10A1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, IF, IHC, IHC-Fr, WB |
Reactivity | Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK), different from the related human sequence by eighteen amino acids, and from the related rat sequence by three amino a |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 39413 MW |
UniProt ID | O08705 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Sodium/bile acid cotransporter;Na (+)/bile acid co Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of HEPA1-6 cells using anti-SLC10A1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of SLC10A1 using anti-SLC10A1 antibody.Lane 1:rat liver tissue; 2:mouse liver tissue.
IF analysis of SLC10A1 using anti- SLC10A1 antibody. SLC10A1 was detected in paraffin-embedded section of mouse liver tissues.
IHC analysis of SLC10A1 using anti-SLC10A1 antibody. SLC10A1 was detected in a paraffin-embedded section of mouse liver tissue.
IHC analysis of SLC10A1 using anti-SLC10A1 antibody. SLC10A1 was detected in a paraffin-embedded section of rat liver tissue.
IHC analysis of SLC10A1 using anti-SLC10A1 antibody. SLC10A1 was detected in frozen section of mouse liver tissue.
ICC, IF, IHC-P, WB | |
Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, ICC, IF, IHC, WB | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating