SIRT5 antibody

• Catalog Number: orb574179
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SIRT5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Goat, Human, Mouse, Porcine, Rabbit
• Reactivity: Bovine, Goat, Human, Mouse, Porcine
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SIRT5
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 33kDa
• Target: SIRT5
• UniProt ID: Q9NXA8
• Protein Sequence: Synthetic peptide located within the following region: LSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILE
• NCBI: NP_112534
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SIR2L5
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human kidney

Human Lung

Rabbit Anti-SIRT5 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SIRT5 Antibody Titration: 1.0-2.0 ug/ml, Positive Control: Jurkat cell lysate.