SIRT2 Rabbit Polyclonal Antibody

• Catalog Number: orb574175
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SIRT2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SIRT2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: SIRT2
• UniProt ID: Q8IXJ6
• Protein Sequence: Synthetic peptide located within the following region: DVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTS
• NCBI: NP_085096
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SIR2, SIR2L, SIR2L2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 1. 30 ug mouse pancreas extract 2. 30 ug mouse pancreas extract 3. 30 ug mouse pancreas extract, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: SIRT2.

WB Suggested Anti-SIRT2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.