SIM1 Rabbit Polyclonal Antibody

• Catalog Number: orb574592
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SIM1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SIM1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 86 kDa
• Target: SIM1
• UniProt ID: P81133
• Protein Sequence: Synthetic peptide located within the following region: SSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLLDPADR
• NCBI: NP_005059
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: bHLHe14
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Mouse embryonic spinal cord. Embryonic day 15.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 86 kDa isoform is identified.

Sample Tissue: Mouse Mouse Brain, Antibody dilution: 1 ug/ml.