You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577445 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SIDT2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SIDT2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 94 kDa |
Target | SIDT2 |
UniProt ID | Q8NBJ9 |
Protein Sequence | Synthetic peptide located within the following region: LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT |
NCBI | NP_001035545 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CGI-40 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.
Host: Rabbit, Target Name: EGFL8, Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. SIDT2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
Host: Rabbit, Target Name: NOP56, Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SERPINA3, Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SIDT2, Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Host: Rabbit, Target Name: SIDT2, Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: WT1, Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. SIDT2 is supported by BioGPS gene expression data to be expressed in 721_B.
Rabbit Anti-SIDT2 antibody, Catalog Number: orb577445, Paraffin Embedded Tissue: Human Placenta cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/ml. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-SIDT2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.
WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating