SIAH1 antibody

• Catalog Number: orb576575
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SIAH1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SIAH1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 31kDa
• Target: SIAH1
• UniProt ID: Q8IUQ4
• Protein Sequence: Synthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
• NCBI: NP_003022
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SIAH1A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Host: Rabbit, Target: SIAH1, Positive control (+): Mouse Brain (M-BR), Negative control (-): Mouse Pancreas (M-PA), Antibody concentration: 1 ug/ml.

Lanes: Lane 1: 50 ug human HEK-293T lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-IgG, Secondary Antibody Dilution: 1:5000, Gene Name: SIAH1, SIAH1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

Liver

WB Suggested Anti-SIAH1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.