SIAH1 antibody

• Catalog Number: orb329760
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SIAH1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SIAH1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: SIAH1
• UniProt ID: Q8IUQ4
• Protein Sequence: Synthetic peptide located within the following region: FTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLA
• NCBI: NP_001006611
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti SIAH1A antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemical staining of human Heart tissue using SIAH1 antibody

Western blot analysis of human HEK293T tissue using SIAH1 antibody

Western blot analysis of Jurkat cell lysate tissue using SIAH1 antibody

Host: Mouse, Target Name: SIAH1A, Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.

Rabbit Anti-SIAH1 antibody, Catalog Number: orb329760, Paraffin Embedded Tissue: Human Heart cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Application: Western blotting Species+tissue/cell type: Human embryonic kidney 293T How many ug’s of tissue/cell lysate run on the gel: 1: 50 ug human HEK-293T cell lysatePrimary antibody Dilution: 1:1000, Secondary antibody: Anti-rabbit-IgG Secondary antibody Dilution: 1:5000.

WB Suggested Anti-SIAH1 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.