You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579687 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SHMT2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SHMT2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | SHMT2 |
UniProt ID | P34897 |
Protein Sequence | Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE |
NCBI | NP_005403 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | GLYA, SHMT, NEDCASB, HEL-S-51e Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human kidney
SHMT2 antibody - C-terminal region (orb579687), Catalog Number: orb579687, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in Kupffer cells, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SHMT2 Antibody Titration: 0.5 ug/ml, Positive Control: HepG2 cell lysate.
ICC, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Canine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating