You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579101 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SHH |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Gallus, Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SHH |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 28 kDa |
Target | SHH |
UniProt ID | Q15465 |
Protein Sequence | Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT |
NCBI | NP_000184 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | TPT, HHG1, HLP3, HPE3, SMMCI, ShhNC, TPTPS, MCOPCB Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Chicken embryos, Primary antibody: 1:1000 (orb579101) anti-shh Secondary Antibody: 1:500 (ASP00001) goat anti-rabbit HRP conjugated.
Host: Mouse, Target Name: SHH, Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.
Host: Rabbit, Target Name: SHH, Sample Tissue: Human Stomach Tumor, Antibody Dilution: 1.0 ug/ml.
Rabbit Anti-SHH Antibody, Catalog Number: orb579101, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Plasma membrane, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Sample Type: Human glioma cells, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-GFP, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: 1. SHH: Green 2. DAPI: Blue 3. Merge, Gene Name: SHH.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-SHH Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
Filter by Rating